LL-37 Peptide Pen
Peptide Name
LL-37 (Lyophilized Powder)
Chemical Name/Structure
-
Chemical Name: Human Cathelicidin CAP-18 (104-140) peptide
-
Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser ([LL-37, 37 aa])
CAS Number
154947-66-7
Core Areas of Research Investigation
-
Broad-Spectrum Antimicrobial Activity: Investigating the peptide's electrostatic interaction with, and disruption of, negatively charged bacterial, viral, and fungal cell membranes.
-
Immunomodulation & Chemotaxis: Evaluating how LL-37 functions as an alarmin, modulating the innate immune response and recruiting key inflammatory cells like neutrophils and T-lymphocytes.
-
Wound Re-epithelialization & Tissue Repair: Assessing the peptide's capacity to stimulate keratinocyte migration, accelerate vascularization (angiogenesis), and promote wound-healing models.
-
Biofilm Disruption & Eradication: Probing the mechanisms by which the peptide prevents bacterial attachment and degrades established pre-formed biofilms of resistant pathogens like Pseudomonas aeruginosa.
-
Autoimmune and Chronic Inflammatory Cascades: Studying the peptide’s binding affinity to self-DNA/RNA and its downstream role in activating plasmacytoid dendritic cells in disease models like psoriasis.
RESEARCH-USE NOTICE
This product is supplied by Biolabs for laboratory and research purposes only. It is not intended to diagnose, treat, cure, or prevent any medical condition and should not be used as a substitute for professional medical advice or treatment.
Any information provided is for general research, product identification, storage, and handling purposes only. The purchaser is responsible for using and storing the product appropriately and in accordance with applicable regulations.